Chickpea Salad

🥗 SaladБГ
Prep15 min
Cook0 min
Total15 min

Chickpeas with cucumber, tomato, red onion and herbs in a lemon dressing — a fifteen-minute lunch that keeps.

Ingredients

Serves:4
  • 480 g cooked chickpeas
  • 1 pieces cucumber, diced
  • 250 g cherry tomatoes, halved
  • 0.5 pieces red onion, finely diced
  • 30 g flat-leaf parsley
  • 100 g feta, crumbled
  • 3 tbsp lemon juice
  • 4 tbsp extra virgin olive oil
  • 0.5 tsp ground cumin
  • 1 pieces garlic clove, crushed

Nutrition (estimated)

high confidence
429kcal · per serving
15.8g
Protein
40.8g
Carbs
23.8g
Fat

Recipe total: 1716 kcal · P 63.3g · C 163.3g · F 95.1g

Estimated from 10 of 10 ingredients

Approximate estimate, calculated from the ingredients.

Steps

  1. 1
    Drain and rinse the chickpeas well, then dry them in a cloth. Wet chickpeas dilute the dressing.
  2. 2
    Rub a few of the chickpeas between your fingers to split their skins — this thickens the dressing slightly and helps it cling.
  3. 3
    Whisk the lemon juice, oil, cumin, garlic, salt and pepper into a dressing.
  4. 4
    Dress the chickpeas first and leave them 10 minutes to absorb it.
  5. 5
    Fold through the cucumber, tomatoes, onion and parsley.
  6. 6
    Add the feta last with a light hand so it stays in pieces.
  7. 7
    Serve at room temperature. It keeps two days, though the cucumber softens.
Advertisement
saladchickpeasmediterraneanvegetarianquickmeal prep
No ratings yet

Sign in to rate this recipe.

Sign in to mark as cooked.