Dairy-Free Fluffy Pancakes
🍳 CookingБГ
Prep10 min
Cook20 min
Total30 min
Light and fluffy pancakes made with oat milk and coconut oil. A perfect dairy-free breakfast that the whole family will love.
Ingredients
Serves:10
Ingredients
- 1.5 cups all-purpose flour
- 2 tsp baking powder
- 2 tbsp sugar
- 1/2 tsp salt
- 1.5 cups oat milk
- 2 eggs
- 2 tbsp coconut oil, melted
- 1 tsp vanilla extract
- 4 tbsp maple syrup, to serve
- 150 g fresh berries, to serve
Nutrition (estimated)
high confidence214kcal · per serving
6.5g
Protein
38.1g
Carbs
3.7g
Fat
Recipe total: 2139 kcal · P 64.6g · C 380.6g · F 36.8g
Estimated from 10 of 10 ingredients
Approximate estimate, calculated from the ingredients.
Steps
Steps
- 1Whisk together flour, baking powder, sugar, and salt in a large bowl.
- 2In a separate bowl, whisk oat milk, eggs, melted coconut oil, and vanilla extract together.
- 3Pour the wet ingredients into the dry ingredients and stir until just combined. Do not overmix; a few lumps are fine.
- 4Heat a non-stick pan over medium heat and lightly grease with coconut oil.
- 5Pour 1/4 cup batter per pancake onto the pan. Cook until bubbles form on the surface, then flip and cook 1 to 2 minutes more.
- 6Serve with the maple syrup and fresh berries.
Advertisement
dairy-freebreakfastpancakesfamily-friendly
Questions and answers
How long does Dairy-Free Fluffy Pancakes take to make?
About 30 minutes: 10 min prep and 20 min cooking.
What ingredients do you need for Dairy-Free Fluffy Pancakes?
10 ingredients: all-purpose flour, baking powder, sugar, salt, oat milk, eggs, coconut oil, vanilla extract, maple syrup, fresh berries.
How many servings does this Dairy-Free Fluffy Pancakes recipe make?
10 servings. The servings buttons above the ingredients rescale every amount.
How many calories are in a serving of Dairy-Free Fluffy Pancakes?
About 214 kcal, with 6.5 g protein, 38.1 g carbohydrate and 3.7 g fat. This is an estimate from the ingredients, not a lab analysis.
Which diets does this Dairy-Free Fluffy Pancakes recipe suit?
It is dairy-free.
No ratings yet
Sign in to rate this recipe.
Sign in to mark as cooked.