French Lentil Salad

🥗 SaladБГ
Prep15 min
Cook25 min
Total40 min

Puy lentils dressed warm with mustard vinaigrette, shallots and plenty of herbs.

Ingredients

Serves:4
  • 300 g Puy or beluga lentils
  • 2 pieces shallots, finely diced
  • 1 pieces carrot
  • 1 pieces bay leaf
  • 2 tsp Dijon mustard
  • 3 tbsp red wine vinegar
  • 6 tbsp extra virgin olive oil
  • 30 g flat-leaf parsley
  • 3 tbsp chives, chopped
  • 1 pieces garlic clove

Nutrition (estimated)

high confidence
338kcal · per serving
8.7g
Protein
23.8g
Carbs
23.3g
Fat

Recipe total: 1352 kcal · P 34.7g · C 95.3g · F 93g

Estimated from 10 of 10 ingredients

Approximate estimate, calculated from the ingredients.

Steps

  1. 1
    Rinse the lentils and simmer them in unsalted water with the whole carrot, garlic clove and bay leaf for 20-25 minutes until tender but intact. Salting the water now makes the skins tough.
  2. 2
    Drain and discard the carrot, garlic and bay.
  3. 3
    Whisk the mustard with the vinegar, then whisk in the oil in a stream to emulsify. Season firmly.
  4. 4
    Pour the dressing over the lentils while they are still hot and fold through the diced shallots.
  5. 5
    Leave 20 minutes to absorb, stirring once or twice.
  6. 6
    Fold through the herbs only once the lentils have cooled to warm, so they stay green.
  7. 7
    Serve warm or at room temperature — it keeps three days in the fridge.
Advertisement
frenchsaladlentilsveganmake-aheadhealthy
No ratings yet

Sign in to rate this recipe.

Sign in to mark as cooked.