French Lentil Salad
🥗 SaladБГ
Prep15 min
Cook25 min
Total40 min
Puy lentils dressed warm with mustard vinaigrette, shallots and plenty of herbs.
Ingredients
Serves:4
Ingredients
- 300 g Puy or beluga lentils
- 2 pieces shallots, finely diced
- 1 pieces carrot
- 1 pieces bay leaf
- 2 tsp Dijon mustard
- 3 tbsp red wine vinegar
- 6 tbsp extra virgin olive oil
- 30 g flat-leaf parsley
- 3 tbsp chives, chopped
- 1 pieces garlic clove
- to taste salt
- to taste black pepper
Nutrition (estimated)
medium confidence338kcal · per serving
8.7g
Protein
23.8g
Carbs
23.3g
Fat
Recipe total: 1352 kcal · P 34.7g · C 95.3g · F 93g
Estimated from 10 of 12 ingredients
Approximate estimate, calculated from the ingredients.
Steps
Steps
- 1Rinse the lentils and simmer them in unsalted water with the whole carrot, garlic clove and bay leaf for 20-25 minutes until tender but intact. Salting the water now makes the skins tough.
- 2Drain and discard the carrot, garlic and bay.
- 3Whisk the mustard with the vinegar, then whisk in the oil in a stream to emulsify. Season firmly with salt and pepper.
- 4Pour the dressing over the lentils while they are still hot and fold through the diced shallots.
- 5Leave 20 minutes to absorb, stirring once or twice.
- 6Fold through the parsley and chives only once the lentils have cooled to warm, so they stay green.
- 7Serve warm or at room temperature — it keeps three days in the fridge.
Advertisement
frenchsaladlentilsveganmake-aheadhealthy
More recipes like this
Questions and answers
How long does French Lentil Salad take to make?
About 40 minutes: 15 min prep and 25 min cooking.
What ingredients do you need for French Lentil Salad?
12 ingredients: Puy or beluga lentils, shallots, carrot, bay leaf, Dijon mustard, red wine vinegar, extra virgin olive oil, flat-leaf parsley, chives, garlic clove, salt, black pepper.
How many servings does this French Lentil Salad recipe make?
4 servings. The servings buttons above the ingredients rescale every amount.
How many calories are in a serving of French Lentil Salad?
About 338 kcal, with 8.7 g protein, 23.8 g carbohydrate and 23.3 g fat. This is an estimate from the ingredients, not a lab analysis.
Which diets does this French Lentil Salad recipe suit?
It is vegan.
What cuisine is French Lentil Salad?
French Lentil Salad comes from French cuisine.
No ratings yet
Sign in to rate this recipe.
Sign in to mark as cooked.