General Tso's Chicken

Name: General Tso's Chicken
Prep time: 25 min
Cook time: 20 min
Total time: 45 min
Yield: 4 servings
Cuisine: Chinese
Ingredients: 700 g boneless, skinless chicken thighs, in 3 cm pieces; 3 tbsp light soy sauce; 2 tbsp Shaoxing wine or dry sherry; 1 egg white; 90 g cornflour, for coating; 1 tbsp cornflour, for the sauce; 1 l sunflower oil, for deep-frying; 3 tbsp Chinkiang black vinegar or rice vinegar; 4 tbsp sugar; 1 tbsp hoisin sauce; 120 ml chicken stock; 8 dried red chillies; 4 cloves garlic, finely chopped; 15 g ginger, finely chopped; 3 spring onions, sliced, white and green parts apart; 1 tsp toasted sesame oil; 1 tsp sesame seeds; 600 g steamed rice, to serve

🍳 CookingБГ

Prep25 min

Cook20 min

Total45 min

The sweet, hot and tangy fried chicken of American Chinese restaurants, first cooked by a chef from Hunan who had moved to Taiwan: crisp pieces of thigh in a dark glaze sharpened with vinegar and dried chillies.

Ingredients

Serves:4

700 g boneless, skinless chicken thighs, in 3 cm pieces
3 tbsp light soy sauce
2 tbsp Shaoxing wine or dry sherry
1 egg white
90 g cornflour, for coating
1 tbsp cornflour, for the sauce
1 l sunflower oil, for deep-frying
3 tbsp Chinkiang black vinegar or rice vinegar
4 tbsp sugar
1 tbsp hoisin sauce
120 ml chicken stock
8 dried red chillies
4 cloves garlic, finely chopped
15 g ginger, finely chopped
3 spring onions, sliced, white and green parts apart
1 tsp toasted sesame oil
1 tsp sesame seeds
600 g steamed rice, to serve

Nutrition (estimated)

high confidence

3474kcal · per serving

73.5g

Protein

179.2g

Carbs

274.9g

Fat

Recipe total: 13896 kcal · P 294.2g · C 716.8g · F 1099.6g

Estimated from 18 of 18 ingredients

Approximate estimate, calculated from the ingredients.

Video

Steps

1
Toss the chicken with 1 tbsp of the soy sauce, 1 tbsp of the Shaoxing wine and the egg white, then leave for 15 minutes.
2
For the sauce, whisk the remaining soy sauce and Shaoxing wine with the vinegar, sugar, hoisin sauce, chicken stock and the cornflour for the sauce.
3
Heat the oil to 175°C. Toss the chicken in the coating cornflour until every piece is dry and fully covered.
4
Fry the chicken in two batches for 5 minutes until golden and cooked through, and drain on a rack. For extra crunch, fry it all again at 190°C for 1 minute.
5
Pour off all but 2 tbsp of the oil. Fry the dried chillies over medium heat for 20 seconds until they darken slightly, then add the garlic, ginger and the white parts of the spring onions for 30 seconds.
6
Stir the sauce and pour it in. Simmer for 1 minute, stirring, until it is thick enough to coat a spoon; a thin sauce turns the crust soggy.
7
Add the chicken and the sesame oil and toss until every piece is glazed.
8
Scatter over the sesame seeds and the green parts of the spring onions and serve at once with the rice.

chinesechickenfriedspicymaindairy-free

More recipes like this

Chinese cuisine 🍗 Chicken 🍚 Rice

Questions and answers

How long does General Tso's Chicken take to make?

About 45 minutes: 25 min prep and 20 min cooking.

What ingredients do you need for General Tso's Chicken?

17 ingredients: boneless, light soy sauce, Shaoxing wine or dry sherry, egg white, cornflour, sunflower oil, Chinkiang black vinegar or rice vinegar, sugar, hoisin sauce, chicken stock, dried red chillies, garlic and 5 more.

How many servings does this General Tso's Chicken recipe make?

4 servings. The servings buttons above the ingredients rescale every amount.

How many calories are in a serving of General Tso's Chicken?

About 3474 kcal, with 73.5 g protein, 179.2 g carbohydrate and 274.9 g fat. This is an estimate from the ingredients, not a lab analysis.

Which diets does this General Tso's Chicken recipe suit?

It is dairy-free.

What cuisine is General Tso's Chicken?

General Tso's Chicken comes from Chinese cuisine.

No ratings yet

← Back to Recipes