Massaged Kale Salad

🥗 SaladБГ
Prep20 min
Cook5 min
Total25 min

Raw kale worked by hand with lemon and oil until it softens and darkens, with Parmesan and toasted almonds.

Ingredients

Serves:4
  • 250 g curly kale or cavolo nero
  • 3 tbsp lemon juice
  • 4 tbsp extra virgin olive oil
  • 60 g Parmesan, shaved
  • 50 g flaked almonds
  • 1 pieces garlic clove
  • 1 tsp Dijon mustard
  • 50 g dried cranberries
  • 0.5 tsp salt

Nutrition (estimated)

high confidence
301kcal · per serving
9.7g
Protein
9.9g
Carbs
25.9g
Fat

Recipe total: 1204 kcal · P 38.8g · C 39.5g · F 103.6g

Estimated from 9 of 9 ingredients

Approximate estimate, calculated from the ingredients.

Steps

  1. 1
    Strip the kale leaves from the tough central stems and discard the stems entirely.
  2. 2
    Shred the leaves into thin ribbons and put them in a large bowl with the salt and half the lemon juice and oil.
  3. 3
    Massage the leaves firmly between your hands for 2-3 minutes. They will shrink by half, darken and turn silky. This is the whole technique — unmassaged kale stays tough and bitter.
  4. 4
    Toast the almonds in a dry pan for 3 minutes until golden.
  5. 5
    Whisk the remaining lemon juice and oil with the mustard and the crushed garlic clove.
  6. 6
    Dress the massaged kale and toss well.
  7. 7
    Fold through the cranberries, then top with Parmesan shavings and almonds. Unlike most salads, this one is fine an hour after dressing.
Advertisement
saladkalerawparmesanvegetarianhealthy
No ratings yet

Sign in to rate this recipe.

Sign in to mark as cooked.