Massaged Kale Salad
🥗 SaladБГ
Prep20 min
Cook5 min
Total25 min
Raw kale worked by hand with lemon and oil until it softens and darkens, with Parmesan and toasted almonds.
Ingredients
Serves:4
Ingredients
- 250 g curly kale or cavolo nero
- 3 tbsp lemon juice
- 4 tbsp extra virgin olive oil
- 60 g Parmesan, shaved
- 50 g flaked almonds
- 1 pieces garlic clove
- 1 tsp Dijon mustard
- 50 g dried cranberries
- 0.5 tsp salt
Nutrition (estimated)
high confidence301kcal · per serving
9.7g
Protein
9.9g
Carbs
25.9g
Fat
Recipe total: 1204 kcal · P 38.8g · C 39.5g · F 103.6g
Estimated from 9 of 9 ingredients
Approximate estimate, calculated from the ingredients.
Steps
Steps
- 1Strip the kale leaves from the tough central stems and discard the stems entirely.
- 2Shred the leaves into thin ribbons and put them in a large bowl with the salt and half the lemon juice and oil.
- 3Massage the leaves firmly between your hands for 2-3 minutes. They will shrink by half, darken and turn silky. This is the whole technique — unmassaged kale stays tough and bitter.
- 4Toast the almonds in a dry pan for 3 minutes until golden.
- 5Whisk the remaining lemon juice and oil with the mustard and the crushed garlic clove.
- 6Dress the massaged kale and toss well.
- 7Fold through the cranberries, then top with Parmesan shavings and almonds. Unlike most salads, this one is fine an hour after dressing.
Advertisement
saladkalerawparmesanvegetarianhealthy
Questions and answers
How long does Massaged Kale Salad take to make?
About 25 minutes: 20 min prep and 5 min cooking.
What ingredients do you need for Massaged Kale Salad?
9 ingredients: curly kale or cavolo nero, lemon juice, extra virgin olive oil, Parmesan, flaked almonds, garlic clove, Dijon mustard, dried cranberries, salt.
How many servings does this Massaged Kale Salad recipe make?
4 servings. The servings buttons above the ingredients rescale every amount.
How many calories are in a serving of Massaged Kale Salad?
About 301 kcal, with 9.7 g protein, 9.9 g carbohydrate and 25.9 g fat. This is an estimate from the ingredients, not a lab analysis.
Which diets does this Massaged Kale Salad recipe suit?
It is vegetarian.
No ratings yet
Sign in to rate this recipe.
Sign in to mark as cooked.